DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spi and igeg-1

DIOPT Version :9

Sequence 1:NP_001027281.1 Gene:spi / 35253 FlyBaseID:FBgn0005672 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001294246.1 Gene:igeg-1 / 185065 WormBaseID:WBGene00017901 Length:274 Species:Caenorhabditis elegans


Alignment Length:112 Identity:26/112 - (23%)
Similarity:50/112 - (44%) Gaps:17/112 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPKRPRPMLEKASIAS 146
            |...||. .|..:..|    :.|.....|.|.||:||:.|: |.:...|..|..: ::...:.:.
 Worm   123 CSSEFDG-ICGTNGIC----LMDGSRQICHCDIGYMGETCD-KVLMGAYDVKLLK-VVGGTTTSL 180

  Fly   147 GAMCALVFMLFVCLAFYLRFEQRAAKKAYELEQELQQEYDDDDGQCE 193
            ..:|.::.:||..|.|.   |:::.::       |::|:.....:||
 Worm   181 NLVCIIIAILFALLYFK---ERKSVRR-------LRREFGKAAEECE 217



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_117627
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.