DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spi and Ereg

DIOPT Version :9

Sequence 1:NP_001027281.1 Gene:spi / 35253 FlyBaseID:FBgn0005672 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_031976.1 Gene:Ereg / 13874 MGIID:107508 Length:162 Species:Mus musculus


Alignment Length:152 Identity:33/152 - (21%)
Similarity:62/152 - (40%) Gaps:22/152 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSISSSMSGTALPPTQAPVTSSTTMRTTTTTTPRPNIT-FPTYKCPETFDAWYCLNDAHCFAVKI 102
            |.:..::..|.:.|:..|..|.............|.:. ....||....|. |||   |...:.:
Mouse    17 SHLLQAVISTTVIPSCIPGESEDNCTALVQMEDDPRVAQVQITKCSSDMDG-YCL---HGQCIYL 77

  Fly   103 ADLPVYSCECAIGFMGQRCEYKEIDNTYLPKRPRPMLEKASIASGAMCALVFMLFV--CLAFYLR 165
            .|:....|.|.:|:.|.|||:..: ..:.|      |.|..:|...:...:|::..  |:.::.|
Mouse    78 VDMREKFCRCEVGYTGLRCEHFFL-TVHQP------LSKEYVALTVILIFLFLIITAGCIYYFCR 135

  Fly   166 -FEQRAAKKAYELEQELQQEYD 186
             ::.|.:||:       ::||:
Mouse   136 WYKNRKSKKS-------REEYE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiNP_001027281.1 None
EregNP_031976.1 PHA03099 <58..141 CDD:165381 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_117627
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.