DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spi and Nrg1

DIOPT Version :9

Sequence 1:NP_001027281.1 Gene:spi / 35253 FlyBaseID:FBgn0005672 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_038950018.1 Gene:Nrg1 / 112400 RGDID:621341 Length:850 Species:Rattus norvegicus


Alignment Length:149 Identity:39/149 - (26%)
Similarity:65/149 - (43%) Gaps:20/149 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TALPPTQAPV----------TSSTTMRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKI 102
            ||...:::|:          |||:|..:||.|:       ...||.|. :..:|:|...||.||.
  Rat   356 TAYVSSESPIRISVSTEGANTSSSTSTSTTGTS-------HLIKCAEK-EKTFCVNGGECFTVKD 412

  Fly   103 ADLPV-YSCECAIGFMGQRCEYKEIDNTYLPKRPRPMLEKASIASGAMC-ALVFMLFVCLAFYLR 165
            ...|. |.|:|..||.|.||...........::...:.:|..:....:| ||:.:..:|:..|.:
  Rat   413 LSNPSRYLCKCQPGFTGARCTENVPMKVQTQEKAEELYQKRVLTITGICIALLVVGIMCVVAYCK 477

  Fly   166 FEQRAAKKAYELEQELQQE 184
            .:::..|....|.|.|:.|
  Rat   478 TKKQRQKLHDRLRQSLRSE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiNP_001027281.1 None
Nrg1XP_038950018.1 Ig_Pro_neuregulin-1 248..340 CDD:409476
Ig strand B 264..268 CDD:409476
Ig strand C 278..282 CDD:409476
Ig strand E 306..310 CDD:409476
Ig strand F 320..325 CDD:409476
Ig strand G 333..336 CDD:409476
EGF_CA <401..433 CDD:238011 14/31 (45%)
Neuregulin 478..832 CDD:396641 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.