DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spi and nrg2a

DIOPT Version :9

Sequence 1:NP_001027281.1 Gene:spi / 35253 FlyBaseID:FBgn0005672 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_005161385.1 Gene:nrg2a / 100006951 ZFINID:ZDB-GENE-070615-10 Length:710 Species:Danio rerio


Alignment Length:142 Identity:32/142 - (22%)
Similarity:58/142 - (40%) Gaps:28/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SSTTMRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRC-- 121
            :||....:.|||..|. :....:|.:| :..||:|...|:  .|..:...||:|...:.|.||  
Zfish   225 TSTVHVQSITTTVSPG-SGHARRCNDT-EKTYCVNGGDCY--YIHGINQLSCKCPNDYTGDRCQT 285

  Fly   122 ------------EYKEIDNTYLPKRPRPMLEKASIASGAMC-ALVFMLFVCLAFYLRFEQRAAKK 173
                        |:.|.:..|         :|..:....:| ||:.:..||:..|.:.:::..|.
Zfish   286 SVMASFYQSLGIEFMEAEELY---------QKRVLTITGICVALLVVGIVCVVAYCKTKKQRKKM 341

  Fly   174 AYELEQELQQEY 185
            ...|.|.:..::
Zfish   342 HNHLRQNIYVDH 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiNP_001027281.1 None
nrg2aXP_005161385.1 IG_like 149..230 CDD:214653 2/4 (50%)
Ig_Pro_neuregulin 158..228 CDD:143227 1/2 (50%)
PHA03099 220..341 CDD:165381 29/128 (23%)
Neuregulin 302..698 CDD:280343 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.