DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13077 and Cyb561d1

DIOPT Version :9

Sequence 1:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001074789.2 Gene:Cyb561d1 / 72023 MGIID:1919273 Length:229 Species:Mus musculus


Alignment Length:251 Identity:56/251 - (22%)
Similarity:99/251 - (39%) Gaps:65/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PIESPR--RYSKMAHGSLSGHEAENRLQRLEYFLNVLNQMCIGFITIYISYLTLRTGLSGTGLHA 96
            |...||  |:.:...|.|:                  :.:.:|| ||:::.|:    ..||.|.:
Mouse    12 PAREPRLTRWLRRGSGILA------------------HLIALGF-TIFLTVLS----RPGTSLFS 53

  Fly    97 W---LVTIGFSFFMAEGVMIHYGGNVLTNGYKRQTKTTIHWVLLTLGGGCGAAGALIKMIQKGFL 158
            |   .:.:.|...|||.:::....:.|.....|:|:..:||...|:...|...|.       ||:
Mouse    54 WHPVFMALAFCLCMAEAILLFSPEHSLFFFCSRKTRIRLHWAGQTMAILCAVLGL-------GFI 111

  Fly   159 LQST-----------HGRLGMTAFV------LCILAMSSGLAALFSSRIKKLITPLLNKTFHNFL 206
            :.|.           |..:|....:      ||.|.:....||.. ||:.:|      |.:|...
Mouse   112 ISSKIRSEMSHLVSWHSWIGALTLLATGGQALCGLCLLCPRAARV-SRVARL------KLYHLTC 169

  Fly   207 GFACFVIALVTQYYGYQTGYFKSRSE-TDFQI-----LMKCLTLISLVLSSYGPMK 256
            |...:::|.||...|..:.:|:::.: |.:.:     |...|.::..:.|||.|.|
Mouse   170 GLVVYLMATVTVLLGMYSVWFQAQIKGTAWYLCLGLPLYPALVIMHQISSSYLPRK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 34/153 (22%)
Cyb561d1NP_001074789.2 Cyt_b561_CYB561D2_like 32..212 CDD:176491 44/198 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849185
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JAN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.