DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13077 and Cyb561d2

DIOPT Version :9

Sequence 1:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_030100321.1 Gene:Cyb561d2 / 56368 MGIID:1929280 Length:270 Species:Mus musculus


Alignment Length:187 Identity:46/187 - (24%)
Similarity:84/187 - (44%) Gaps:11/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TLRTGLSGTGLHAW---LVTIGFSFFMAEGVMIHYGGNVLTNGYKRQTKTTIHWVLLTLGGGCGA 145
            ::|..|...||.:|   |:::.|||.|.|.:::....:.|.....|:.:...||||..|...|..
Mouse    82 SMRRPLLIPGLFSWHPVLMSLAFSFLMTEALLMFSPESSLLRSLSRKVRARCHWVLQLLALLCAL 146

  Fly   146 AGALIKMIQKGFL----LQSTHGRLGMTAFVLCILAMSSGLAALFSSRIKKLITPLLN-KTFHNF 205
            .|..:.::.|..|    |.:.||:.|:.|.:...|..|.|:..|:...:.:  .||.. |.:|..
Mouse   147 LGLGLVILHKEQLGKAHLTTRHGQAGLLAVLWAGLQCSGGMGLLYPKLLPR--WPLAKLKLYHAT 209

  Fly   206 LGFACFVIALVTQYYGYQTGYFKSR-SETDFQILMKCLTLISLVLSSYGPMKALYQK 261
            .|...:::...:...|..:.:|.:. :...:.:.:.|..|.|||:.:......||:|
Mouse   210 SGLVGYLLGSASLLLGMFSLWFTATVTGGAWYLAVLCPILTSLVIMNQVSNAYLYRK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 34/141 (24%)
Cyb561d2XP_030100321.1 Cyt_b561_CYB561D2_like 91..253 CDD:176491 39/163 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849182
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JAN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.