DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13077 and cyb561d2

DIOPT Version :9

Sequence 1:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_012816466.1 Gene:cyb561d2 / 496973 XenbaseID:XB-GENE-854864 Length:266 Species:Xenopus tropicalis


Alignment Length:199 Identity:45/199 - (22%)
Similarity:89/199 - (44%) Gaps:23/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ITIYISYLTLRTGLSGTGLHAWLVTIGFSFFMAEGVMIHYGGNVLTNGYKRQTKTTIHWVLLTLG 140
            :|:|:.::: :.|.:....|.:|:|:.|||.|.|.:::....:.|...:.|:.:..:||||..|.
 Frog    74 LTVYMIFVS-QPGATLFSWHPFLMTLAFSFLMTEAILVFSPDSSLLRSFSRRARVQVHWVLQLLC 137

  Fly   141 GGCGAAGALI----KMIQKGFLLQSTHGRLGMTAFVLCILAMSSGLAALFSSRIKK--LITPLLN 199
            ..|...|..|    |::|......:.||.||:...:..:|....|:..|:...:::  |.|   .
 Frog   138 VVCSLLGLGIIYSNKVLQGKPHFSTWHGLLGVLTVLWTLLQSVGGVTLLYPKLVQRWNLAT---R 199

  Fly   200 KTFH-------NFLGFACFVIALVTQYYGYQTGYFKSRSETDFQILMKCLTLISLVLSSYGPMKA 257
            |.:|       ..||....::.:.:.::|      .|.:...:.:.:.|..|..||:.:......
 Frog   200 KLYHATAGLIGYLLGCGSLLLGMCSLWFG------ASVTGLSWYLCVLCPVLTGLVIMNQVSNAY 258

  Fly   258 LYQK 261
            ||:|
 Frog   259 LYRK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 34/146 (23%)
cyb561d2XP_012816466.1 Cyt_b561_CYB561D2_like 69..249 CDD:176491 40/184 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.