DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13077 and cyb561d2

DIOPT Version :9

Sequence 1:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001006102.1 Gene:cyb561d2 / 450082 ZFINID:ZDB-GENE-041010-205 Length:222 Species:Danio rerio


Alignment Length:210 Identity:51/210 - (24%)
Similarity:86/210 - (40%) Gaps:16/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HEAENRLQRLE-----YFLNVLNQMCIGFITIYISYLTLRTGLSGTGLHAWLVTIGFSFFMAEGV 111
            ||:|.:|.|..     .|.:||..:..||||     ...|...|....|.:|:|:.|||.|.|.:
Zfish     5 HESEPKLYRYSRTVCGIFTHVLCALFTGFIT-----ALARPSSSLFSWHPFLMTLSFSFLMTEAI 64

  Fly   112 MIHYGGNVLTNGYKRQTKTTIHWVLLTLGGGCGAAGALIKMIQKGF----LLQSTHGRLGMTAFV 172
            ::....:...:..|.:||..:||:|..|...|...|.......|..    ...|.||.:|:....
Zfish    65 LLFIPHSSPVSKLKHKTKGRLHWILQCLCVFCATLGLFAIFYNKSLNDKPHFTSWHGLIGVVTVA 129

  Fly   173 LCILAMSSGLAALFSSRIKKLITPLLNKTFHNFLGFACFVIALVTQYYGYQTGYFKSR-SETDFQ 236
            :.:....:||..|:....|......| |.:|...|...:::...:.:.|..:.:|... |...:.
Zfish   130 VVVFQAVAGLLLLYPKLAKNWTLAKL-KRYHATSGLLTYLLGSFSLFLGLCSSWFSGAVSGYVWY 193

  Fly   237 ILMKCLTLISLVLSS 251
            :.:.|..:.:||:.|
Zfish   194 LAVLCPVVCALVVMS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 31/137 (23%)
cyb561d2NP_001006102.1 Cyt_b561_CYB561D2_like 26..205 CDD:176491 41/184 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JAN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5390
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.