DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13077 and CG13078

DIOPT Version :9

Sequence 1:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster


Alignment Length:211 Identity:106/211 - (50%)
Similarity:146/211 - (69%) Gaps:3/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LQRLEYFLNVLNQMCIGFITIYISYLTLRTGLSGTGLHAWLVTIGFSFFMAEGVMIHYGGNVLTN 122
            ||.:|..|.|:||:||||:||:||:..||..|||..|||||||.||.|.||||:|..|.|:.||.
  Fly    12 LQHIESALYVINQLCIGFVTIWISWTCLRQDLSGIRLHAWLVTFGFVFLMAEGMMCFYDGSWLTV 76

  Fly   123 GYKRQTKTTIHWVLLTLGGGCGAAGALIKMIQKGFLLQST-HGRLGMTAFVLCILAMSSGLAALF 186
            .|.|..||..|.||..||||.|.||.||::|:..:.:..| |.|||..|||||::::.|||.|..
  Fly    77 RYSRNYKTAFHVVLQILGGGMGVAGCLIQLIRDDWSISVTLHARLGFAAFVLCLISLLSGLVAFL 141

  Fly   187 SSRIKKLITPLLNKTFHNFLGFACFVIALVTQYYGY-QTGYFKSRSETDFQILMKCLTLISLVLS 250
            :..:.:.|:||:|||||..|.|..||||::.|:||| |||.|:.:.: ||.:||:.:|::.:||:
  Fly   142 ARCLSRTISPLVNKTFHVVLSFTAFVIAMMAQFYGYTQTGIFRGQGQ-DFVVLMQVVTMVLMVLT 205

  Fly   251 SYGPMKALYQKCKNIS 266
            |.|.:|:||||..:::
  Fly   206 SIGAIKSLYQKIGSLA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 71/135 (53%)
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:281217 71/135 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468758
Domainoid 1 1.000 78 1.000 Domainoid score I15623
eggNOG 1 0.900 - - E1_28JAN
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133840at33392
OrthoFinder 1 1.000 - - FOG0009995
OrthoInspector 1 1.000 - - mtm9713
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.