DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13077 and CG10337

DIOPT Version :9

Sequence 1:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_609986.1 Gene:CG10337 / 35247 FlyBaseID:FBgn0032805 Length:239 Species:Drosophila melanogaster


Alignment Length:201 Identity:55/201 - (27%)
Similarity:88/201 - (43%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FLNVLNQMCIGFITIYISYLTLRTGLSGTGLHAWLVTIGFSFFMAEGVMIHYGGNVLTNGYKRQT 128
            |..:::.:.:..||:.|.|..|...|..|..||:..||||.|||.|.:::. ....|.:......
  Fly    17 FCTLISHVLLAGITVAIVYKCLVLKLVHTAGHAFYCTIGFVFFMGEALLVR-NSAYLESSLGPLN 80

  Fly   129 KTTIHWVLLTLGGGCGAAGALIKMIQKGFL-------------LQSTHGRLGMTAFVLCILAMSS 180
            ...:|.||..|....||.|..||..||  |             .:|.|...|:....|.:.::.|
  Fly    81 LNRLHAVLGLLAFLVGAGGIGIKTWQK--LERKREDPNATVRHFKSNHAFYGIIGCALLLGSVLS 143

  Fly   181 GLAALFSSRIKKLITPLLNKTFHNFLGFACFVIALVTQYYGYQTGYFKSRSETDFQILMKCLTLI 245
            ||...|      :.:....|..|.|.|.:.|::.:|:|.:||.||:.:.:.:...|.|.|..|.|
  Fly   144 GLPLYF------INSGFALKMLHRFFGLSGFLVLMVSQMFGYNTGFGRRQWKAHHQKLFKFFTFI 202

  Fly   246 SLVLSS 251
            :.:.::
  Fly   203 ATITTA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 42/146 (29%)
CG10337NP_609986.1 B561 48..179 CDD:214769 38/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.