DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13077 and CG3592

DIOPT Version :9

Sequence 1:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_570039.1 Gene:CG3592 / 31282 FlyBaseID:FBgn0029642 Length:249 Species:Drosophila melanogaster


Alignment Length:238 Identity:51/238 - (21%)
Similarity:93/238 - (39%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ENRLQRLEYFLNVLNQMCIGFITIYISYLTLRTGLS--GTGLHAWLVTIGFSFFMAEGVMIHYG- 116
            |..|.|:  .|.:|..:.:..||:.:...|  :||.  .:|.||....:|....:.|.:::.:. 
  Fly    27 EVNLYRI--ILELLAHILLIVITVVMVKKT--SGLDDHSSGQHALYAILGLFLCVGESLLVCHSW 87

  Fly   117 --GNVLTNGYKRQTKTTIHWVLLTLGGGCGAAGALIKMIQKGFL----LQSTHGRLGMTAFVLCI 175
              |:.::    ......:|.||..:|...|..|...|.|.|..:    ..|.||..|:..|:|..
  Fly    88 WLGDFIS----ENRLNLLHMVLGMVGLWLGLVGIFAKSIFKSKIHEPHFNSKHGLCGLLGFLLIA 148

  Fly   176 LAMSSGLAALFSSRIKKLITPLLNKTFHNFLGFACFVIALVTQYYGYQTGYFKSR---------- 230
            .|::||.|.:       ..|.|.....|..:|...||:...:|::....|:.:..          
  Fly   149 GAVASGFALV-------CFTHLALHVIHRLMGLCGFVLLSCSQWFALNLGFARREWSSWKIKRLR 206

  Fly   231 --------SETDFQILMKCLTLISLVLSSYGPMKALYQKCKNI 265
                    |...::.|..|..::.|:.:|:  .||:..|..::
  Fly   207 ISTLAATISVVSYEFLCLCRDIVHLLPNSW--FKAIGLKIDHL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 32/140 (23%)
CG3592NP_570039.1 Cyt_b561 65..189 CDD:176489 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.