DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13077 and CYB561D2

DIOPT Version :9

Sequence 1:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001278213.1 Gene:CYB561D2 / 11068 HGNCID:30253 Length:222 Species:Homo sapiens


Alignment Length:197 Identity:51/197 - (25%)
Similarity:91/197 - (46%) Gaps:10/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MCIGFITIYISYLTLRTGLSGTGLHAWLVTIGFSFFMAEGVMIHYGGNVLTNGYKRQTKTTIHWV 135
            :.:|| ||:::.|. |.|.|....|..|:::.|||.|.|.:::....:.|.:...|:.:...|||
Human    26 VALGF-TIFVAVLA-RPGSSLFSWHPVLMSLAFSFLMTEALLVFSPESSLLHSLSRKGRARCHWV 88

  Fly   136 LLTLGGGCGAAGALIKMIQKGFL----LQSTHGRLGMTAFVLCILAMSSGLAALFSSRIKKLITP 196
            |..|...|...|..:.::.|..|    |.:.||:.|:.|.:...|..|.|:..|:...:.:  .|
Human    89 LQLLALLCALLGLGLVILHKEQLGKAHLVTRHGQAGLLAVLWAGLQCSGGVGLLYPKLLPR--WP 151

  Fly   197 LLN-KTFHNFLGFACFVIALVTQYYGYQTGYF-KSRSETDFQILMKCLTLISLVLSSYGPMKALY 259
            |.. |.:|...|...:::...:...|..:.:| .|.:...:.:.:.|..|.|||:.:......||
Human   152 LAKLKLYHATSGLVGYLLGSASLLLGMCSLWFTASVTGAAWYLAVLCPVLTSLVIMNQVSNAYLY 216

  Fly   260 QK 261
            :|
Human   217 RK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 34/139 (24%)
CYB561D2NP_001278213.1 Cyt_b561_CYB561D2_like 25..205 CDD:176491 46/182 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5503
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.