DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13078 and AT2G30890

DIOPT Version :9

Sequence 1:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_180646.1 Gene:AT2G30890 / 817639 AraportID:AT2G30890 Length:257 Species:Arabidopsis thaliana


Alignment Length:99 Identity:23/99 - (23%)
Similarity:43/99 - (43%) Gaps:12/99 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IRLHAWLVTFGFVFLMAEG-----MMCFYDGSWLTVRYSRNYKTAF-HVVLQILGGGMGVAGCLI 104
            |::|.:::......||..|     :|...|...:|:|     :..| ||..|::...:...|.::
plant    53 IKVHGFMLWAAMGVLMPIGIISIRLMSIKDQPIITLR-----RLFFLHVTSQMVAVILVTIGAVM 112

  Fly   105 QLIRDDWSISVTLHARLGFAAFVLCLISLLSGLV 138
            .:|..:.|.| ..|.:||...:|:.....|.|.:
plant   113 SVINFNNSFS-NHHQQLGIGLYVIVWFQALLGFL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:281217 22/97 (23%)
AT2G30890NP_180646.1 Cyt_b561_FRRS1_like 53..213 CDD:176490 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.