DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13078 and Cyb561d2

DIOPT Version :9

Sequence 1:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_030100321.1 Gene:Cyb561d2 / 56368 MGIID:1929280 Length:270 Species:Mus musculus


Alignment Length:210 Identity:48/210 - (22%)
Similarity:87/210 - (41%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LCIGFVTIWISWTCLRQDLSGIRLHAW---LVTFGFVFLMAEGMMCFYDGSWLTVRYSRNYKTAF 86
            ||......|:.  .:|:.|....|.:|   |::..|.|||.|.::.|...|.|....||..:...
Mouse    71 LCCCACQTWLH--SMRRPLLIPGLFSWHPVLMSLAFSFLMTEALLMFSPESSLLRSLSRKVRARC 133

  Fly    87 HVVLQILG-----GGMGVAGCLIQLIRDDWSIS--VTLHARLGFAAFVLCLISLLSGLVAFLARC 144
            |.|||:|.     .|:|    |:.|.::....:  .|.|.:.|..|.:...:....|:.....:.
Mouse   134 HWVLQLLALLCALLGLG----LVILHKEQLGKAHLTTRHGQAGLLAVLWAGLQCSGGMGLLYPKL 194

  Fly   145 LSRTISPLVN-KTFHV-------VLSFTAFVIAMMAQFYGYTQTGIFRGQGQDFVVLMQVVTMVL 201
            |.|.  ||.. |.:|.       :|...:.::.|.:.::..|.||     |..::.::..:...|
Mouse   195 LPRW--PLAKLKLYHATSGLVGYLLGSASLLLGMFSLWFTATVTG-----GAWYLAVLCPILTSL 252

  Fly   202 MVLTSIGAIKSLYQK 216
            :::..: :...||:|
Mouse   253 VIMNQV-SNAYLYRK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:281217 38/153 (25%)
Cyb561d2XP_030100321.1 Cyt_b561_CYB561D2_like 91..253 CDD:176491 39/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849184
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JAN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - O PTHR15422
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.