DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13078 and cyb561d1

DIOPT Version :9

Sequence 1:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001004590.1 Gene:cyb561d1 / 447851 ZFINID:ZDB-GENE-040912-157 Length:238 Species:Danio rerio


Alignment Length:186 Identity:45/186 - (24%)
Similarity:75/186 - (40%) Gaps:39/186 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GIRLHAW---LVTFGFVFLMAEGMMCF-YDGSWLTVRYSRNYKTAFHVVLQIL-------GGGMG 98
            |..|.:|   .::.||...|.||::.| .:||....: ||.:|...|...|.|       |.|..
Zfish    57 GTSLFSWHPVCMSLGFGLCMTEGILLFSAEGSPFCFK-SRKWKVRLHWFFQALLLICGATGLGFM 120

  Fly    99 VAGCLIQLIRD-----DWSISVTLHARLGFAAFVLCLISLLSGLVAFLARCLSRTISPLVNKTFH 158
            ||.   :.|::     .|      |:.||.:.....|:..:.|::....:.:|....|.: :.:|
Zfish   121 VAS---KNIKEHQHFKSW------HSYLGVSTMATTLLQAICGVLLIFPKLISTRSFPRL-RLYH 175

  Fly   159 VVLSFTAFVIA----MMAQFYGYTQ---TGIFRGQGQDFVVLMQVVTMVLMVLTSI 207
            ......|:::|    |.|.|..:.|   ||.|.     :|.|...:...|:|:..|
Zfish   176 ATCGLVAYLLATVTLMSAMFTDWFQASVTGTFW-----YVFLFLPLFPALVVMNQI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:281217 38/158 (24%)
cyb561d1NP_001004590.1 Cyt_b561_CYB561D2_like 41..221 CDD:176491 42/179 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594747
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JAN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5390
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - O PTHR15422
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.