DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13078 and CYB561D1

DIOPT Version :9

Sequence 1:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_011539589.2 Gene:CYB561D1 / 284613 HGNCID:26804 Length:290 Species:Homo sapiens


Alignment Length:136 Identity:31/136 - (22%)
Similarity:54/136 - (39%) Gaps:8/136 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IRLHAWLVTFGFVFLMAEGMMCFYDGSWLTVRYSRNYKTAFH---VVLQILGGGMGVAGCLIQLI 107
            :||...|:...|...|||.::.|.....|....||..:...|   ..|.||...:|:...:....
Human   113 MRLTGSLLCSQFCLCMAEAILLFSPEHSLFFFCSRKARIRLHWAGQTLAILCAALGLGFIISSRT 177

  Fly   108 RDDWSISVTLHARLGFAAFVLCLISLLSGLVAFLARC--LSRTISPLVNKTFHVVLSFTAFVIAM 170
            |.:....|:.|:.:|....:...:..|.||.....|.  :|| ::.|  |.:|:......:::|.
Human   178 RSELPHLVSWHSWVGALTLLATAVQALCGLCLLCPRAARVSR-VARL--KLYHLTCGLVVYLMAT 239

  Fly   171 MAQFYG 176
            :....|
Human   240 VTVLLG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:281217 30/134 (22%)
CYB561D1XP_011539589.2 Cyt_b561_CYB561D2_like 124..273 CDD:176491 28/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158804
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JAN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5503
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.