DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13078 and CYB561D2

DIOPT Version :9

Sequence 1:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001278213.1 Gene:CYB561D2 / 11068 HGNCID:30253 Length:222 Species:Homo sapiens


Alignment Length:219 Identity:54/219 - (24%)
Similarity:87/219 - (39%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HIESAL-----YVINQLCIGFVTIWISWTCLRQDLSGIRLHAWLVTFGFVFLMAEGMMCFYDGSW 73
            ||..||     ...:.:.:|| ||::: ...|...|....|..|::..|.|||.|.::.|...|.
Human    10 HIYRALRTASGAAAHLVALGF-TIFVA-VLARPGSSLFSWHPVLMSLAFSFLMTEALLVFSPESS 72

  Fly    74 LTVRYSRNYKTAFHVVLQILG-----GGMGVAGCLIQLIRDDWSIS--VTLHARLGFAAFVLCLI 131
            |....||..:...|.|||:|.     .|:|    |:.|.::....:  ||.|.:.|..|.:...:
Human    73 LLHSLSRKGRARCHWVLQLLALLCALLGLG----LVILHKEQLGKAHLVTRHGQAGLLAVLWAGL 133

  Fly   132 SLLSGLVAFLARCLSRTISPLVN-KTFHVVLSFTAFVIAMMAQFYGYTQ---TGIFRGQGQDFVV 192
            ....|:.....:.|.|.  ||.. |.:|.......:::...:...|...   |....|......|
Human   134 QCSGGVGLLYPKLLPRW--PLAKLKLYHATSGLVGYLLGSASLLLGMCSLWFTASVTGAAWYLAV 196

  Fly   193 LMQVVTMVLMVLTSIGAIKSLYQK 216
            |..|:|.::::.....|.  ||:|
Human   197 LCPVLTSLVIMNQVSNAY--LYRK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:281217 35/146 (24%)
CYB561D2NP_001278213.1 Cyt_b561_CYB561D2_like 25..205 CDD:176491 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5503
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - O PTHR15422
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.