DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13078 and cyb561d1

DIOPT Version :9

Sequence 1:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_017947028.1 Gene:cyb561d1 / 101734093 XenbaseID:XB-GENE-22068331 Length:271 Species:Xenopus tropicalis


Alignment Length:147 Identity:36/147 - (24%)
Similarity:60/147 - (40%) Gaps:41/147 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGIRLHAWLVT--------FGFVFLMAEGMMCFYDGSWLTVRYSRNYKTAFHVVLQI--LGGGMG 98
            |..||| |||.        .||.|:     :|..:      |..:.:.|::|.:|.:  ||....
 Frog   130 SKTRLH-WLVQLCVPLLAGIGFAFI-----VCSKN------RSEQLHMTSWHSILGVFTLGATFC 182

  Fly    99 VAGCLIQLIRDDWS-ISVT-----LHARLGFAAFVLCLISLLSGLVA--FLAR--------CLSR 147
            .|.|.:.|:....: ||..     .||..|...::|...::|.||.:  |.|:        ||:.
 Frog   183 QAVCGLALLCPRLARISAVSRLKLYHATCGLLVYLLATSTVLLGLCSDWFQAQIKGPVWYICLAL 247

  Fly   148 TISP---LVNKTFHVVL 161
            .:.|   ::|:...:.|
 Frog   248 PLYPALIIMNQVLDIYL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:281217 34/143 (24%)
cyb561d1XP_017947028.1 Cyt_b561_CYB561D2_like 93..254 CDD:176491 34/135 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.