DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13078 and cyb561d1

DIOPT Version :10

Sequence 1:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_017947028.1 Gene:cyb561d1 / 101734093 XenbaseID:XB-GENE-22068331 Length:271 Species:Xenopus tropicalis


Alignment Length:147 Identity:36/147 - (24%)
Similarity:60/147 - (40%) Gaps:41/147 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SGIRLHAWLVT--------FGFVFLMAEGMMCFYDGSWLTVRYSRNYKTAFHVVLQI--LGGGMG 98
            |..||| |||.        .||.|:     :|..:      |..:.:.|::|.:|.:  ||....
 Frog   130 SKTRLH-WLVQLCVPLLAGIGFAFI-----VCSKN------RSEQLHMTSWHSILGVFTLGATFC 182

  Fly    99 VAGCLIQLIRDDWS-ISVT-----LHARLGFAAFVLCLISLLSGLVA--FLAR--------CLSR 147
            .|.|.:.|:....: ||..     .||..|...::|...::|.||.:  |.|:        ||:.
 Frog   183 QAVCGLALLCPRLARISAVSRLKLYHATCGLLVYLLATSTVLLGLCSDWFQAQIKGPVWYICLAL 247

  Fly   148 TISP---LVNKTFHVVL 161
            .:.|   ::|:...:.|
 Frog   248 PLYPALIIMNQVLDIYL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:427188 34/143 (24%)
cyb561d1XP_017947028.1 Cyt_b561_CYB561D2_like 93..254 CDD:176491 34/135 (25%)

Return to query results.
Submit another query.