DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep4 and AI182371

DIOPT Version :9

Sequence 1:NP_001260590.1 Gene:Tep4 / 35248 FlyBaseID:FBgn0041180 Length:1498 Species:Drosophila melanogaster
Sequence 2:XP_017174840.1 Gene:AI182371 / 98870 MGIID:2138853 Length:366 Species:Mus musculus


Alignment Length:271 Identity:59/271 - (21%)
Similarity:101/271 - (37%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RADAFAVSLCVILALLQTMEPVKAEGKYTIVGPGTIHSHRDYNVAVAVHQTKEPVTLKVGITG-P 66
            :|..|..:|..::.|.|:..  :.:.:|.|..|.........||.|..|...|.....|.:.. |
Mouse    17 QAMGFWGTLLFLIFLEQSWG--QEQTRYIISTPIVFRVGAPENVTVQAHGHTEAFDTTVSVKSYP 79

  Fly    67 SYN---KTETVELATAGEFKQ---ITFKLPPLEAGEYNLTAEGVKGLEFKNSTKLN-----WENF 120
            ..|   ...||.|:...:|:.   :|.:...|..|: |..:.....:..|:..||.     ::|.
Mouse    80 DENVRYSFSTVNLSPENKFQNTAILTIQAKQLSEGQ-NSFSNSYLEVVSKHFAKLEIVPIIYDND 143

  Fly   121 KPYIKIQTDKGKYKPGDTINYRVIFLDENLRPDTAKDEVVVWFEDSKRNRIKQEKHIKTTGGVYT 185
            ..:  :||||..|.|...:..||..::::|.|.|.  |.|:.|.|.:.:::...:....||....
Mouse   144 SLF--VQTDKSVYTPQQPVKVRVYSVNDDLEPATR--ETVLTFIDPEGSQVDTIEGNNLTGIASF 204

  Fly   186 GKFELSEFATLGSWSLHVQ-NGDQHHDGGIYFGGRKQFGGFGHRWHRSDELVNFEVEKYVLPKYS 249
            ..||:......|.|::..: ..|....|..|                      |||::|      
Mouse   205 PDFEIPSNPKHGRWTVKAKYREDASKTGTTY----------------------FEVKEY------ 241

  Fly   250 VKMDATQQVSV 260
               |.|.::|:
Mouse   242 ---DKTYRISI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep4NP_001260590.1 A2M_N 126..219 CDD:280081 24/93 (26%)
A2M_N_2 528..653 CDD:285005
A2M 768..859 CDD:278630
A2M_2 982..1279 CDD:239227
A2M_comp 1035..1281 CDD:284982
A2M_recep 1389..1479 CDD:284981
AI182371XP_017174840.1 MG1 42..138 CDD:375333 22/96 (23%)
A2M_N 145..238 CDD:376626 25/118 (21%)
ANATO 279..347 CDD:237984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2373
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.