powered by:
Protein Alignment Tep4 and ei24
DIOPT Version :9
Sequence 1: | NP_001260590.1 |
Gene: | Tep4 / 35248 |
FlyBaseID: | FBgn0041180 |
Length: | 1498 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017187.1 |
Gene: | ei24 / 549941 |
XenbaseID: | XB-GENE-990260 |
Length: | 340 |
Species: | Xenopus tropicalis |
Alignment Length: | 46 |
Identity: | 15/46 - (32%) |
Similarity: | 20/46 - (43%) |
Gaps: | 19/46 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 1061 DPVRNGSTW------LTA-----YVLRSF--SKI------KDIIDL 1087
||..:|..| ||: :||..| ||: :||.||
Frog 107 DPSLHGDVWSWLEFILTSVFSALWVLPLFVLSKVVNAIWFQDIADL 152
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165169184 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.