DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep4 and ei24

DIOPT Version :9

Sequence 1:NP_001260590.1 Gene:Tep4 / 35248 FlyBaseID:FBgn0041180 Length:1498 Species:Drosophila melanogaster
Sequence 2:NP_001017187.1 Gene:ei24 / 549941 XenbaseID:XB-GENE-990260 Length:340 Species:Xenopus tropicalis


Alignment Length:46 Identity:15/46 - (32%)
Similarity:20/46 - (43%) Gaps:19/46 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1061 DPVRNGSTW------LTA-----YVLRSF--SKI------KDIIDL 1087
            ||..:|..|      ||:     :||..|  ||:      :||.||
 Frog   107 DPSLHGDVWSWLEFILTSVFSALWVLPLFVLSKVVNAIWFQDIADL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep4NP_001260590.1 A2M_N 126..219 CDD:280081
A2M_N_2 528..653 CDD:285005
A2M 768..859 CDD:278630
A2M_2 982..1279 CDD:239227 15/46 (33%)
A2M_comp 1035..1281 CDD:284982 15/46 (33%)
A2M_recep 1389..1479 CDD:284981
ei24NP_001017187.1 EI24 120..254 CDD:399918 11/33 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165169184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.