powered by:
Protein Alignment Tep4 and LOC108644460
DIOPT Version :9
Sequence 1: | NP_001260590.1 |
Gene: | Tep4 / 35248 |
FlyBaseID: | FBgn0041180 |
Length: | 1498 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031761281.1 |
Gene: | LOC108644460 / 108644460 |
-ID: | - |
Length: | 119 |
Species: | Xenopus tropicalis |
Alignment Length: | 70 |
Identity: | 23/70 - (32%) |
Similarity: | 36/70 - (51%) |
Gaps: | 5/70 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 1412 IRNIERVRLVETKNGDSVVVIYFENL-AKNEEKCIRIEAYRTHAVANQKPSSVVLYDYYDTNKKA 1475
:.|.:.:...|.||.. |.:|..:: :|..|..:::| ..:.|.|..||||..||||||::..
Frog 47 LENEKLISRYELKNNH--VFLYLSSVSSKTVELPLKME--MGNRVLNVAPSSVYAYDYYDTDQNG 107
Fly 1476 TEYYS 1480
...||
Frog 108 YAAYS 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D354230at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.