DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep4 and LOC101886227

DIOPT Version :9

Sequence 1:NP_001260590.1 Gene:Tep4 / 35248 FlyBaseID:FBgn0041180 Length:1498 Species:Drosophila melanogaster
Sequence 2:XP_021322237.1 Gene:LOC101886227 / 101886227 -ID:- Length:140 Species:Danio rerio


Alignment Length:152 Identity:36/152 - (23%)
Similarity:58/152 - (38%) Gaps:53/152 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLQTMEPVKAEGKYTIVGPGTIHSHRDYNVAVAVHQTKEPVTLKVGITGPSYNKTETVELATAGE 81
            |||.    |||.::          ||.:|....:.:.:....:||.:.|.|:|.||.        
Zfish    42 LLQE----KAEQEF----------HRCFNFQAPLAEAESVQKIKVELQGESFNMTEE-------- 84

  Fly    82 FKQITFKLPPLEAGEYNLTAEGVKGLEFKNSTKLNWENFKPYIKIQTDKGKYKPGDTINYRVIFL 146
             :::.||                              ::.|...||.||..|..|.|:|:||:.:
Zfish    85 -RKVMFK------------------------------SYHPLTFIQMDKPFYIAGQTVNFRVVTM 118

  Fly   147 DENLRPDTAKDEVVVWFEDSKR 168
            |::.||...:...||..|.|.:
Zfish   119 DKSFRPLDQQYSAVVLEELSNK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep4NP_001260590.1 A2M_N 126..219 CDD:280081 17/43 (40%)
A2M_N_2 528..653 CDD:285005
A2M 768..859 CDD:278630
A2M_2 982..1279 CDD:239227
A2M_comp 1035..1281 CDD:284982
A2M_recep 1389..1479 CDD:284981
LOC101886227XP_021322237.1 A2M_N 96..>135 CDD:327702 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D177369at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.