DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tep4 and LOC101731171

DIOPT Version :10

Sequence 1:NP_001260590.1 Gene:Tep4 / 35248 FlyBaseID:FBgn0041180 Length:1498 Species:Drosophila melanogaster
Sequence 2:XP_012809794.2 Gene:LOC101731171 / 101731171 XenbaseID:XB-GENE-29085151 Length:165 Species:Xenopus tropicalis


Alignment Length:61 Identity:30/61 - (49%)
Similarity:37/61 - (60%) Gaps:9/61 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1222 SQDVEITSYALLSLL------DSDQETADSVLNTVRWLIAQRNGFGGFASSQDTVVGLTAL 1276
            |.:||:.||.||:||      |.|...|..|   |.|:|.|:|..|||:|:|||||.|.||
 Frog    55 SAEVEMNSYMLLALLSKPNVSDDDLTLATQV---VSWMIKQQNPNGGFSSTQDTVVALQAL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tep4NP_001260590.1 YfaS <76..1411 CDD:441940 30/61 (49%)
A2M_2 982..1279 CDD:239227 30/61 (49%)
A2M_recep 1387..1480 CDD:462226
LOC101731171XP_012809794.2 TED_complement <1..115 CDD:462227 30/61 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.