DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10337 and cyb561d2

DIOPT Version :9

Sequence 1:NP_609986.1 Gene:CG10337 / 35247 FlyBaseID:FBgn0032805 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001006102.1 Gene:cyb561d2 / 450082 ZFINID:ZDB-GENE-041010-205 Length:222 Species:Danio rerio


Alignment Length:163 Identity:43/163 - (26%)
Similarity:70/163 - (42%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CTLISHVLLA---GITVAIVYKCLVLKLVHTAGHAFYCTIGFVFFMGEALL--VRNSAYLESSLG 77
            |.:.:|||.|   |...|:......|    .:.|.|..|:.|.|.|.||:|  :.:|:.: |.|.
Zfish    19 CGIFTHVLCALFTGFITALARPSSSL----FSWHPFLMTLSFSFLMTEAILLFIPHSSPV-SKLK 78

  Fly    78 PLNLNRLHAVLGLLAFLVGAGGIGIKTWQKLERKREDPNATVRHFKSNHAFYGIIGCALLLGSVL 142
            .....|||.:|..|.......|:....:.|  ...:.|     ||.|.|...|::..|:::...:
Zfish    79 HKTKGRLHWILQCLCVFCATLGLFAIFYNK--SLNDKP-----HFTSWHGLIGVVTVAVVVFQAV 136

  Fly   143 SGLPLYF--INSGFALKMLHRFFGLSGFLVLMV 173
            :||.|.:  :...:.|..|.|:...||.|..::
Zfish   137 AGLLLLYPKLAKNWTLAKLKRYHATSGLLTYLL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10337NP_609986.1 B561 48..179 CDD:214769 35/130 (27%)
cyb561d2NP_001006102.1 Cyt_b561_CYB561D2_like 26..205 CDD:176491 40/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.