DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10337 and Cyb561d2

DIOPT Version :9

Sequence 1:NP_609986.1 Gene:CG10337 / 35247 FlyBaseID:FBgn0032805 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001007754.1 Gene:Cyb561d2 / 363137 RGDID:1359644 Length:222 Species:Rattus norvegicus


Alignment Length:172 Identity:45/172 - (26%)
Similarity:69/172 - (40%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SHVLLAGITVAIVYKCLVLKLVHT---AGHAFYCTIGFVFFMGEALLVRN-SAYLESSLGPLNLN 82
            :|::..|.|:.:.    ||....:   :.|....::.|.|.|.||||:.: .:.|..||......
  Rat    23 AHLVALGFTIFVA----VLARPGSSLFSWHPVLMSLAFSFLMTEALLMFSPESSLLRSLSRKVRA 83

  Fly    83 RLHAVLGLLAFLVGAGGIGIKTWQKLERKREDPNATVRHFKSNHAFYGII-----------GCAL 136
            |.|.||.|||.|....|:|:....|.:..:       .|..:.|...|::           |..|
  Rat    84 RCHWVLQLLALLCALLGLGLVILHKEQLGK-------AHLATRHGQAGLLAVLWAGLQCSGGVGL 141

  Fly   137 LLGSVLSGLPLYFINSGFALKMLHRFFGLSGFLVLMVSQMFG 178
            |...:|...||      ..||:.|...||.|:|:...|.:.|
  Rat   142 LYPKLLPRWPL------AKLKLYHATSGLVGYLLGSTSLLLG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10337NP_609986.1 B561 48..179 CDD:214769 40/143 (28%)
Cyb561d2NP_001007754.1 Cyt_b561_CYB561D2_like 25..205 CDD:176491 44/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.