DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10337 and CG3592

DIOPT Version :9

Sequence 1:NP_609986.1 Gene:CG10337 / 35247 FlyBaseID:FBgn0032805 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_570039.1 Gene:CG3592 / 31282 FlyBaseID:FBgn0029642 Length:249 Species:Drosophila melanogaster


Alignment Length:211 Identity:79/211 - (37%)
Similarity:111/211 - (52%) Gaps:10/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LYFGFCTLISHVLLAGITVAIVYKCLVLKLVHTAG-HAFYCTIGFVFFMGEALLVRNSAYLESSL 76
            ||.....|::|:||..|||.:|.|...|. .|::| ||.|..:|....:||:|||.:|.:|...:
  Fly    30 LYRIILELLAHILLIVITVVMVKKTSGLD-DHSSGQHALYAILGLFLCVGESLLVCHSWWLGDFI 93

  Fly    77 GPLNLNRLHAVLGLLAFLVGAGGIGIKTWQKLERKREDPNATVRHFKSNHAFYGIIGCALLLGSV 141
            ....||.||.|||::...:|..||..|:..|  .|..:|     ||.|.|...|::|..|:.|:|
  Fly    94 SENRLNLLHMVLGMVGLWLGLVGIFAKSIFK--SKIHEP-----HFNSKHGLCGLLGFLLIAGAV 151

  Fly   142 LSGLPLYFINSGFALKMLHRFFGLSGFLVLMVSQMFGYNTGFGRRQWKAHHQKLFKFFTFIATIT 206
            .||..|... :..||.::||..||.||::|..||.|..|.||.||:|.:...|..:..|..|||:
  Fly   152 ASGFALVCF-THLALHVIHRLMGLCGFVLLSCSQWFALNLGFARREWSSWKIKRLRISTLAATIS 215

  Fly   207 TANYELRRFVRDVAGL 222
            ..:||.....||:..|
  Fly   216 VVSYEFLCLCRDIVHL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10337NP_609986.1 B561 48..179 CDD:214769 49/130 (38%)
CG3592NP_570039.1 Cyt_b561 65..189 CDD:176489 49/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.