DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10337 and CYB561D1

DIOPT Version :9

Sequence 1:NP_609986.1 Gene:CG10337 / 35247 FlyBaseID:FBgn0032805 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_011539589.2 Gene:CYB561D1 / 284613 HGNCID:26804 Length:290 Species:Homo sapiens


Alignment Length:107 Identity:29/107 - (27%)
Similarity:43/107 - (40%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RLHAVLGLLAFLVGAGGIGIKTWQKLERKREDPNATVRHFKSNHAFYGIIGCALLLGSVLSGLPL 147
            |||.....||.|..|.|:|...   ..|.|.:    :.|..|.|::.|.:.........|.||.|
Human   152 RLHWAGQTLAILCAALGLGFII---SSRTRSE----LPHLVSWHSWVGALTLLATAVQALCGLCL 209

  Fly   148 YF-----INSGFALKMLHRFFGLSGFLVLMVSQMFG-YNTGF 183
            ..     ::....||:.|...||..:|:..|:.:.| |:..|
Human   210 LCPRAARVSRVARLKLYHLTCGLVVYLMATVTVLLGMYSVWF 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10337NP_609986.1 B561 48..179 CDD:214769 27/101 (27%)
CYB561D1XP_011539589.2 Cyt_b561_CYB561D2_like 124..273 CDD:176491 29/107 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15422
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.