DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ref(2)P and AT4G13440

DIOPT Version :10

Sequence 1:NP_476700.1 Gene:ref(2)P / 35246 FlyBaseID:FBgn0003231 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001328777.1 Gene:AT4G13440 / 826976 AraportID:AT4G13440 Length:193 Species:Arabidopsis thaliana


Alignment Length:50 Identity:17/50 - (34%)
Similarity:23/50 - (46%) Gaps:9/50 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 VECDGCGLAPLIGFRYKCVQC------SNYDLCQKCEL--AHKHPEHLML 166
            :.|..| |..|.|..:.||.|      :.:|||.||.:  .:.||..|.|
plant    89 INCRTC-LRILNGLYFTCVTCFESSCGNTFDLCVKCYMRRTYCHPHRLFL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ref(2)PNP_476700.1 PB1 6..88 CDD:413452
ZZ 121..165 CDD:395451 15/47 (32%)
UBA_SQSTM 555..593 CDD:270505
AT4G13440NP_001328777.1 FRQ1 <25..80 CDD:444056
ZZ 91..132 CDD:412288 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.