DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ref(2)P and mib1

DIOPT Version :9

Sequence 1:	NP_001014491.1	Gene:	ref(2)P / 35246	FlyBaseID:	FBgn0003231	Length:	599	Species:	Drosophila melanogaster
Sequence 2:	NP_648826.2	Gene:	mib1 / 39750	FlyBaseID:	FBgn0263601	Length:	1226	Species:	Drosophila melanogaster

Alignment Length:	87	Identity:	28/87 - (32%)
Similarity:	36/87 - (41%)	Gaps:	7/87 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    94 EEPKATKQEGSSANAEAPS------VDDPSNFTIHDAVECDGCGLAPLIGFRYKCVQCSNYDLCQ 152
            ||.......|::||.....      :|.......|:...||.|...|:.|.|:||.:|.|||||.
  Fly   140 EEVVVVWDNGTAANYRCAGAYDLRILDSAPTGVKHEGTMCDTCRQQPIFGIRWKCAECINYDLCS 204

  Fly   153 KCELAHKHP-EHLMLRMPTNNG 173
            .|....||. .|...|:.|..|
  Fly   205 ICYHGDKHHLRHRFYRITTPGG 226

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ref(2)P	NP_001014491.1	PB1	6..88	CDD:295447
		ZZ	121..165	CDD:278966	19/44 (43%)
		UBA_SQSTM	555..593	CDD:270505
mib1	NP_648826.2	MIB_HERC2	109..165	CDD:284184	5/24 (21%)
		ZZ_Mind_bomb	177..221	CDD:239079	18/43 (42%)
		MIB_HERC2	248..312	CDD:284184
		Ank_4	568..620	CDD:290365
		ANK repeat	568..598	CDD:293786
		ANK repeat	600..631	CDD:293786
		Ank_2	606..697	CDD:289560
		ANK	628..756	CDD:238125
		ANK repeat	633..664	CDD:293786
		ANK repeat	666..695	CDD:293786
		ANK repeat	699..733	CDD:293786
		Ank_2	704..800	CDD:289560
		ANK	734..872	CDD:238125
		ANK repeat	735..767	CDD:293786
		ANK repeat	769..800	CDD:293786
		Ank_2	774..862	CDD:289560
		ANK repeat	802..862	CDD:293786
		zf-C3HC4_3	968..1011	CDD:290631
		zf-C3HC4_3	1013..1058	CDD:290631
		zf-C3HC4_3	1179..1222	CDD:290631
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4582
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900