DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ref(2)P and sqst-5

DIOPT Version :9

Sequence 1:NP_001014491.1 Gene:ref(2)P / 35246 FlyBaseID:FBgn0003231 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_497158.3 Gene:sqst-5 / 28661656 WormBaseID:WBGene00269434 Length:192 Species:Caenorhabditis elegans


Alignment Length:186 Identity:44/186 - (23%)
Similarity:67/186 - (36%) Gaps:71/186 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LRREIEL-YLFQERQLPK--------CDVR---------TFWIDADKDEIEI-VNQNDYEIFLAK 78
            |.:|.|| ::.|||:|..        |:.:         ||....||..:|| :::.|       
 Worm     3 LTKEEELEFIPQERRLDVLVNAQKTICETKEKKGRIVFVTFATKFDKKVVEITLDEED------- 60

  Fly    79 CESNMHVQVAPLAPVEEPKATKQEGSSANAEAPSVDDPSNF------------------------ 119
                         |:.:...|.||.....:....:|:|:|.                        
 Worm    61 -------------PLSQLYKTAQEIFPYFSWRFCLDEPTNLIEGLSNKRRVFGSIKQSRFYNFLY 112

  Fly   120 -------TIHDAVECDGCGLAPLIGFRYKCVQCSNYDLCQKCELAHKHPEHLMLRM 168
                   |.| ..:||.|........||||..|::||||::||..:.|..|.|||:
 Worm   113 LVITLLPTYH-PFDCDECKAECNWNNRYKCTICADYDLCRQCEAKNLHANHAMLRI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ref(2)PNP_001014491.1 PB1 6..88 CDD:295447 16/73 (22%)
ZZ 121..165 CDD:278966 17/43 (40%)
UBA_SQSTM 555..593 CDD:270505
sqst-5NP_497158.3 ZZ_NBR1_like 126..167 CDD:239080 18/40 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524999at33208
OrthoFinder 1 1.000 - - FOG0002104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.