DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ref(2)P and SPBP35G2.11c

DIOPT Version :9

Sequence 1:NP_001014491.1 Gene:ref(2)P / 35246 FlyBaseID:FBgn0003231 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001342955.1 Gene:SPBP35G2.11c / 2541353 PomBaseID:SPBP35G2.11c Length:397 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:36/111 - (32%)
Similarity:51/111 - (45%) Gaps:23/111 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NDYEIFLAKCE--------SNMH--VQVAPLAPVEEPK--ATKQEGSSANAEAPSVDDPSNFTIH 122
            :||:|    ||        ||.|  |::....|...|.  ...|..|:...|:.|       |:|
pombe   154 DDYDI----CESCLTDNSHSNTHAFVRI
TKAYPHGLPSFHLFPQFLSAELFESAS-------TVH 207

  Fly   123 DAVECDGCGLAPLIGFRYKCVQCSNYDLCQKCELAHKHPEHLMLRM 168
            .:|:||.|...|::|.|:.|:.|.:||||..|.....|..|.|||:
pombe   208 RSVQCDNCLAHPIVGPRFHCLVCEDYDLCSSCVSHVHHDHHSMLRL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ref(2)PNP_001014491.1 PB1 6..88 CDD:295447 9/27 (33%)
ZZ 121..165 CDD:278966 17/43 (40%)
UBA_SQSTM 555..593 CDD:270505
SPBP35G2.11cNP_001342955.1 ZnF_ZZ 56..>91 CDD:197633
ZZ_NBR1_like 134..177 CDD:239080 9/26 (35%)
ZZ 210..253 CDD:294208 18/42 (43%)
NBR1_like 275..385 CDD:271343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I3449
eggNOG 1 0.900 - - E1_KOG4582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.