DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ref(2)P and sqst-2

DIOPT Version :9

Sequence 1:NP_001014491.1 Gene:ref(2)P / 35246 FlyBaseID:FBgn0003231 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_501171.2 Gene:sqst-2 / 189791 WormBaseID:WBGene00021495 Length:242 Species:Caenorhabditis elegans


Alignment Length:202 Identity:43/202 - (21%)
Similarity:72/202 - (35%) Gaps:62/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YLRMPSQNYTILRREIELYLFQER-------QLPKCDVRTFWIDA--------------DKDEIE 65
            |.|.||  |:.:.|:|.:..:...       .|.|.:.....|:|              ....|.
 Worm    16 YERTPS--YSTIPRDIHVSFYHNNYHRSKILYLNKFNAMEKLIEAAHELYPSNGVYRLFSDSTIG 78

  Fly    66 IVNQNDYEIFLAKCESN-------MHVQVAPLAPVEEPKATKQEGSSANAEAPSVDDPSNFTIHD 123
            ..|:.:..:.:.:|..|       :|:::...    .|::..:.....|  .|.:..||..:||.
 Worm    79 AQNELNDSVQVMECVQNPDHILPHLHIRLEDY----RPRSISRNYHEVN--VPIIRTPSQHSIHQ 137

  Fly   124 AVE-------------------------CDGCGLAPLIGFRYKCVQCSNYDLCQKCELAHKHPEH 163
            :|.                         |..| ...::|.||.|:||.:||:|..||....|.||
 Worm   138 SVRFNDNKRHHHHHHHDSIRNFVHHDTPCRNC-FRIIVGSRYHCLQCPDYDICGDCEKDLVHYEH 201

  Fly   164 LMLRMPT 170
            .:||:.|
 Worm   202 ALLRIVT 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ref(2)PNP_001014491.1 PB1 6..88 CDD:295447 16/93 (17%)
ZZ 121..165 CDD:278966 19/68 (28%)
UBA_SQSTM 555..593 CDD:270505
sqst-2NP_501171.2 ZZ_NBR1_like 166..206 CDD:239080 17/40 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157576
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275680at2759
OrthoFinder 1 1.000 - - FOG0002104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15090
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.