DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ref(2)P and sqst-4

DIOPT Version :9

Sequence 1:NP_001014491.1 Gene:ref(2)P / 35246 FlyBaseID:FBgn0003231 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_507173.1 Gene:sqst-4 / 189561 WormBaseID:WBGene00012516 Length:177 Species:Caenorhabditis elegans


Alignment Length:47 Identity:20/47 - (42%)
Similarity:28/47 - (59%) Gaps:1/47 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 HDAVECDGCGLAPLIGFRYKCVQCSNYDLCQKCELAHKHPEHLMLRM 168
            |..|.||.| ...:.|.|:||..|::||:|..||..:.|.:|.|||:
 Worm   130 HPIVRCDSC-YTTITGHRFKCTICTDYDICSSCEARNAHAQHTMLRI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ref(2)PNP_001014491.1 PB1 6..88 CDD:295447
ZZ 121..165 CDD:278966 17/42 (40%)
UBA_SQSTM 555..593 CDD:270505
sqst-4NP_507173.1 ZZ_NBR1_like 133..175 CDD:239080 18/42 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157577
Domainoid 1 1.000 53 1.000 Domainoid score I7600
eggNOG 1 0.900 - - E1_KOG4582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275680at2759
OrthoFinder 1 1.000 - - FOG0002104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4736
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.