powered by:
Protein Alignment ref(2)P and sqst-4
DIOPT Version :9
Sequence 1: | NP_001014491.1 |
Gene: | ref(2)P / 35246 |
FlyBaseID: | FBgn0003231 |
Length: | 599 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507173.1 |
Gene: | sqst-4 / 189561 |
WormBaseID: | WBGene00012516 |
Length: | 177 |
Species: | Caenorhabditis elegans |
Alignment Length: | 47 |
Identity: | 20/47 - (42%) |
Similarity: | 28/47 - (59%) |
Gaps: | 1/47 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 HDAVECDGCGLAPLIGFRYKCVQCSNYDLCQKCELAHKHPEHLMLRM 168
|..|.||.| ...:.|.|:||..|::||:|..||..:.|.:|.|||:
Worm 130 HPIVRCDSC-YTTITGHRFKCTICTDYDICSSCEARNAHAQHTMLRI 175
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160157577 |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I7600 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4582 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S7489 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1275680at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002104 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4736 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.820 |
|
Return to query results.
Submit another query.