DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ref(2)P and sqst-3

DIOPT Version :9

Sequence 1:NP_001014491.1 Gene:ref(2)P / 35246 FlyBaseID:FBgn0003231 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_507738.1 Gene:sqst-3 / 188950 WormBaseID:WBGene00012067 Length:229 Species:Caenorhabditis elegans


Alignment Length:160 Identity:41/160 - (25%)
Similarity:62/160 - (38%) Gaps:44/160 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ILRREIELYLFQERQLPKCDVRTFWIDADKDEIEIVNQNDYEIFLAK---CESNMHVQVAPLAPV 93
            |.||...|:       |..|.|.|..:.....:||.:.::...::.:   |  .....|..|.|:
 Worm    77 ISRRARSLF-------PGSDWRIFSGNPYHSNVEIHSSSEIYSYIKRTTIC--GFEYLVINLEPI 132

  Fly    94 EEPKATKQEGSSANAEAPSVDDPSNFTIHDAVECDGCGLAPLIGFRYKCVQCSNYDLCQKCELAH 158
            .||..|..|..:                    :||.|| ..:.|.||||..|:::|:|::||...
 Worm   133 VEPHHTNSEFYA--------------------KCDSCG-TQIAGRRYKCTMCADFDICERCEAKS 176

  Fly   159 KHPEHLMLRMPTN-----------NGPGMV 177
            .|.:|.|||:.|.           |.|..|
 Worm   177 VHLQHAMLRISTGLRTEIPGYITMNAPSYV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ref(2)PNP_001014491.1 PB1 6..88 CDD:295447 11/58 (19%)
ZZ 121..165 CDD:278966 16/43 (37%)
UBA_SQSTM 555..593 CDD:270505
sqst-3NP_507738.1 ZZ_NBR1_like 144..186 CDD:239080 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157580
Domainoid 1 1.000 53 1.000 Domainoid score I7600
eggNOG 1 0.900 - - E1_KOG4582
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275680at2759
OrthoFinder 1 1.000 - - FOG0002104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.