powered by:
Protein Alignment CG31697 and selenoi
DIOPT Version :10
| Sequence 1: | NP_724209.1 |
Gene: | CG31697 / 35243 |
FlyBaseID: | FBgn0051697 |
Length: | 147 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001316366.1 |
Gene: | selenoi / 557632 |
ZFINID: | ZDB-GENE-091204-137 |
Length: | 400 |
Species: | Danio rerio |
| Alignment Length: | 45 |
Identity: | 11/45 - (24%) |
| Similarity: | 17/45 - (37%) |
Gaps: | 19/45 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 83 SLDKGVDEKYEMKHNTPQPM------------------TVNQIYG 109
:|| |||.|...:.|:..|: ||..::|
Zfish 102 TLD-GVDGKQARRTNSSTPLGELFDHGLDSWACVFFVATVYSVFG 145
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG31697 | NP_724209.1 |
None |
| selenoi | NP_001316366.1 |
PRK10832 |
6..382 |
CDD:469774 |
11/45 (24%) |
Return to query results.
Submit another query.
