DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31697 and Chpt1

DIOPT Version :10

Sequence 1:NP_724209.1 Gene:CG31697 / 35243 FlyBaseID:FBgn0051697 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001140162.1 Gene:Chpt1 / 212862 MGIID:2384841 Length:406 Species:Mus musculus


Alignment Length:30 Identity:11/30 - (36%)
Similarity:13/30 - (43%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ENLNEGGRESLRETIYTTTAE--YERPLSL 45
            |.|:......|.|..||...|  :|.||.|
Mouse    19 EPLSAAQLRRLEEHRYTAVGESLFEPPLQL 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31697NP_724209.1 None
Chpt1NP_001140162.1 PRK10832 19..382 CDD:469774 11/30 (37%)

Return to query results.
Submit another query.