DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31697 and LOC1279849

DIOPT Version :10

Sequence 1:NP_724209.1 Gene:CG31697 / 35243 FlyBaseID:FBgn0051697 Length:147 Species:Drosophila melanogaster
Sequence 2:XP_319628.4 Gene:LOC1279849 / 1279849 VectorBaseID:AGAMI1_006363 Length:387 Species:Anopheles gambiae


Alignment Length:37 Identity:11/37 - (29%)
Similarity:17/37 - (45%) Gaps:10/37 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PMTVNQIYGWYSDRAHRYLRRDR---------GTFVF 128
            ||.|..:|..|.||..: :|..:         |:|:|
Mosquito   237 PMVVYNMYRSYKDRTGK-MRTMKEAMRPLFTYGSFMF 272

Return to query results.
Submit another query.