DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and AT2G30890

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_180646.1 Gene:AT2G30890 / 817639 AraportID:AT2G30890 Length:257 Species:Arabidopsis thaliana


Alignment Length:224 Identity:48/224 - (21%)
Similarity:81/224 - (36%) Gaps:60/224 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 INHILIFLVAVFFFIL--------ARSLEFK--------------------DTAMHMFMTGTGFH 57
            |:|.|  ||::.|.:|        .|||...                    :..:|.||......
plant     3 IHHQL--LVSLLFLLLPLCSSQENTRSLAIDVNGPVETSPISEKLNPKLVYEIKVHGFMLWAAMG 65

  Fly    58 VLIAQAMMS----HSKVNPLTRWLSHRNKSRFHAILQIVGGSMVLLGSLGKFSSKEVHFNTWHGR 118
            ||:...::|    ..|..|:   ::.|.....|...|:|...:|.:|::....:....|:..|.:
plant    66 VLMPIGIISIRLMSIKDQPI---ITLRRLFFLHVTSQMVAVILVTIGAVMSVINFNNSFSNHHQQ 127

  Fly   119 VGGAASFFCAASIVGGFV-NYFQPKFALKVMPPSELRFR------HNLFGLVTFSLGMGAIYLGY 176
            :|           :|.:| .:||..... :.||.|.:.|      |.:.|.....||:..||.|.
plant   128 LG-----------IGLYVIVWFQALLGF-LRPPREEKARRKWFVGHWILGTSIAILGIINIYTGL 180

  Fly   177 --YSKFFTKYVD--TDFIPGMMLITGIVY 201
              |:|..:|..:  |......:....:||
plant   181 HAYAKKTSKSANLWTILFTAQLSCIALVY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 34/147 (23%)
AT2G30890NP_180646.1 Cyt_b561_FRRS1_like 53..213 CDD:176490 38/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.