DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and Cyb561d1

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001074789.2 Gene:Cyb561d1 / 72023 MGIID:1919273 Length:229 Species:Mus musculus


Alignment Length:230 Identity:58/230 - (25%)
Similarity:93/230 - (40%) Gaps:29/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KATAWLQIHSLLNSINHILIFLVAVFFFILARSLEFKDTAM---HMFMTGTGFHVLIAQAMMSHS 68
            :.|.||:..|      .||..|:|:.|.|....|....|::   |.......|.:.:|:|::..|
Mouse    17 RLTRWLRRGS------GILAHLIALGFTIFLTVLSRPGTSLFSWHPVFMALAFCLCMAEAILLFS 75

  Fly    69 KVNPLTRWLSHRNKSRFH------AILQIVGGSMVLLGSLGKFSSKEVHFNTWHGRVGGAASFFC 127
            ..:.|..:.|.:.:.|.|      |||..|.|...::.|  |..|:..|..:||..:|.......
Mouse    76 PEHSLFFFCSRKTRIRLHWAGQTMAILCAVLGLGFIISS--KIRSEMSHLVSWHSWIGALTLLAT 138

  Fly   128 AASIVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSLGMGAIYLGYYSKFFTKYVDTDFIPG 192
            ....:.|.. ...|: |.:|...:.|:..|...|||.:.:....:.||.||.:|...:..   ..
Mouse   139 GGQALCGLC-LLCPR-AARVSRVARLKLYHLTCGLVVYLMATVTVLLGMYSVWFQAQIKG---TA 198

  Fly   193 MMLITGI-VY-GLTIIAPVSSLLTKLKYRSKKKAE 225
            ..|..|: :| .|.|:..:||     .|..:||.|
Mouse   199 WYLCLGLPLYPALVIMHQISS-----SYLPRKKVE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 34/143 (24%)
Cyb561d1NP_001074789.2 Cyt_b561_CYB561D2_like 32..212 CDD:176491 44/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.