DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and Cyb561d2

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_030100321.1 Gene:Cyb561d2 / 56368 MGIID:1929280 Length:270 Species:Mus musculus


Alignment Length:178 Identity:50/178 - (28%)
Similarity:78/178 - (43%) Gaps:30/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HMFMTGTGFHVLIAQAMMSHSKVNPLTRWLSHRNKSRFHAILQIVGGSMVLLG---------SLG 103
            |..:....|..|:.:|::..|..:.|.|.||.:.::|.|.:||::.....|||         .||
Mouse    96 HPVLMSLAFSFLMTEALLMFSPESSLLRSLSRKVRARCHWVLQLLALLCALLGLGLVILHKEQLG 160

  Fly   104 KFSSKEVHFNTWHGRVGGAASFFCAASIVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSLG 168
            |     .|..|.||:.|..|..:......|| :....||. |...|.::|:..|...|||.:.||
Mouse   161 K-----AHLTTRHGQAGLLAVLWAGLQCSGG-MGLLYPKL-LPRWPLAKLKLYHATSGLVGYLLG 218

  Fly   169 MGAIYLGYYSKFFTKYVDTDFIPGMMLITGIVYGLTIIAPVSSLLTKL 216
            ..::.||.:|.:||           ..:||..:.|.::.|:   ||.|
Mouse   219 SASLLLGMFSLWFT-----------ATVTGGAWYLAVLCPI---LTSL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 41/142 (29%)
Cyb561d2XP_030100321.1 Cyt_b561_CYB561D2_like 91..253 CDD:176491 50/178 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 1 1.000 - - FOG0003706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - LDO PTHR15422
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10256
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.