DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and cyb561d1

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001004590.1 Gene:cyb561d1 / 447851 ZFINID:ZDB-GENE-040912-157 Length:238 Species:Danio rerio


Alignment Length:229 Identity:50/229 - (21%)
Similarity:92/229 - (40%) Gaps:39/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WLQIHSLLNSINHILIFLVAVFFFILAR---SLEFKDTAMHMFMTGTGFHVLIAQAMMSHSKVNP 72
            ||:..|::.:  ||:...:.|..|||:|   ||    .:.|......||.:.:.:.::..|....
Zfish    30 WLRRLSVVAA--HIVSLGLVVLTFILSRPGTSL----FSWHPVCMSLGFGLCMTEGILLFSAEGS 88

  Fly    73 LTRWLSHRNKSRFHAILQIVGGSMVLLGSLG---KFSSKEV----HFNTWHGRVGGAASFFCAAS 130
            ...:.|.:.|.|.|...|.:   :::.|:.|   ..:||.:    ||.:||..:|.:........
Zfish    89 PFCFKSRKWKVRLHWFFQAL---LLICGATGLGFMVASKNIKEHQHFKSWHSYLGVSTMATTLLQ 150

  Fly   131 IVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSLG----MGAIYLGYY-----SKFFTKYVD 186
            .:.|.:..|....:.:..|  .||..|...|||.:.|.    |.|::..::     ..|:..::.
Zfish   151 AICGVLLIFPKLISTRSFP--RLRLYHATCGLVAYLLATVTLMSAMFTDWFQASVTGTFWYVFLF 213

  Fly   187 TDFIPGMMLITGIVYGLTIIAPVSSLLTKLKYRS 220
            ....|.::::..|         .|:.|.|.|..|
Zfish   214 LPLFPALVVMNQI---------TSAFLPKKKITS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 31/150 (21%)
cyb561d1NP_001004590.1 Cyt_b561_CYB561D2_like 41..221 CDD:176491 40/188 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594746
Domainoid 1 1.000 55 1.000 Domainoid score I11130
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5390
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 1 1.000 - - FOG0003706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.