DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and Cyb561d2

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001007754.1 Gene:Cyb561d2 / 363137 RGDID:1359644 Length:222 Species:Rattus norvegicus


Alignment Length:223 Identity:60/223 - (26%)
Similarity:96/223 - (43%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TKATAWLQIHSLLNSINHILIFLVAVFFFILAR---SLEFKDTAMHMFMTGTGFHVLIAQAMMSH 67
            |::..:..:.:...:..|::.....:|..:|||   ||    .:.|..:....|..|:.:|::..
  Rat     7 TESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSL----FSWHPVLMSLAFSFLMTEALLMF 67

  Fly    68 SKVNPLTRWLSHRNKSRFHAILQIVGGSMVLLG---------SLGKFSSKEVHFNTWHGRVGGAA 123
            |..:.|.|.||.:.::|.|.:||::.....|||         .|||     .|..|.||:.|..|
  Rat    68 SPESSLLRSLSRKVRARCHWVLQLLALLCALLGLGLVILHKEQLGK-----AHLATRHGQAGLLA 127

  Fly   124 SFFCAASIVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSLGMGAIYLGYYSKFFTKYVDTD 188
            ..:......|| |....||. |...|.::|:..|...|||.:.||..::.||..|.:||..|   
  Rat   128 VLWAGLQCSGG-VGLLYPKL-LPRWPLAKLKLYHATSGLVGYLLGSTSLLLGMCSLWFTANV--- 187

  Fly   189 FIPGMMLITGIVYGLTIIAPVSSLLTKL 216
                    ||..:.|.::.|:   ||.|
  Rat   188 --------TGGAWYLAVLCPI---LTSL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 42/143 (29%)
Cyb561d2NP_001007754.1 Cyt_b561_CYB561D2_like 25..205 CDD:176491 58/205 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 1 1.000 - - FOG0003706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - LDO PTHR15422
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.