DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and Cyb561d1

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001264165.1 Gene:Cyb561d1 / 362017 RGDID:1310829 Length:229 Species:Rattus norvegicus


Alignment Length:233 Identity:54/233 - (23%)
Similarity:91/233 - (39%) Gaps:35/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KATAWLQIHSLLNSINHILIFLVAVFFFILARSLEFKDTAM---HMFMTGTGFHVLIAQAMMSHS 68
            :.|.||:..|      .||..|:|:.|.|....|....|::   |.......|.:.:|:|::..|
  Rat    17 RLTRWLRRGS------GILAHLIALGFTIFLTVLSRPGTSLFSWHPVFMALAFCLCMAEAILLFS 75

  Fly    69 KVNPLTRWLSHRNKSRFH------AILQIVGGSMVLLGSLGKFSSKEVHFNTWHGRVGGAASFFC 127
            ..:.|..:.|.:.:.|.|      |||....|...::.|  |..|:..|..:||..:|.......
  Rat    76 PEHSLFFFCSRKTRIRLHWAGQTMAILCAAVGLGFIISS--KIRSELSHLVSWHSWMGALTLLAT 138

  Fly   128 AASIVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSLGMGAIYLGYYSKFFTKYVDTDFIPG 192
            ....:.| :....|: |.:|...:.|:..|...|||.:.:....:.||.||.:|           
  Rat   139 GGQALCG-LGLLCPR-AARVSRVARLKLYHMTCGLVVYLMATVTVLLGMYSVWF----------- 190

  Fly   193 MMLITGIVYGLTIIAPVSSLLTKL-----KYRSKKKAE 225
            ...|.|..:.|.::.|:...|..:     .|..:||.:
  Rat   191 QAQIKGAAWYLCLVLPLYPALVIMHQISSSYLPRKKVD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 33/143 (23%)
Cyb561d1NP_001264165.1 Cyt_b561_CYB561D2_like 32..212 CDD:176491 44/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 1 1.000 - - FOG0003706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.