DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and CG13077

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_609990.1 Gene:CG13077 / 35252 FlyBaseID:FBgn0032810 Length:269 Species:Drosophila melanogaster


Alignment Length:210 Identity:54/210 - (25%)
Similarity:89/210 - (42%) Gaps:1/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QIHSLLNSINHILIFLVAVFFFILARSLEFKDTAMHMFMTGTGFHVLIAQAMMSHSKVNPLTRWL 77
            ::...||.:|.:.|..:.::...|........|.:|.::...||...:|:.:|.|...|.||...
  Fly    60 RLEYFLNVLNQMCIGFITIYISYLTLRTGLSGTGLHAWLVTIGFSFFMAEGVMIHYGGNVLTNGY 124

  Fly    78 SHRNKSRFHAILQIVGGSMVLLGSLGKFSSKEVHFNTWHGRVGGAASFFCAASIVGGFVNYFQPK 142
            ..:.|:..|.:|..:||.....|:|.|...|.....:.|||:|..|...|..::..|....|..:
  Fly   125 KRQTKTTIHWVLLTLGGGCGAAGALIKMIQKGFLLQSTHGRLGMTAFVLCILAMSSGLAALFSSR 189

  Fly   143 FALKVMPPSELRFRHNLFGLVTFSLGMGAIYLGYYSKFFTKYVDTDFIPGMMLITGIVYGLTIIA 207
            ....:.|.....| ||..|...|.:.:...|.||.:.:|....:|||...|..:|.|...|:...
  Fly   190 IKKLITPLLNKTF-HNFLGFACFVIALVTQYYGYQTGYFKSRSETDFQILMKCLTLISLVLSSYG 253

  Fly   208 PVSSLLTKLKYRSKK 222
            |:.:|..|.|..|::
  Fly   254 PMKALYQKCKNISQQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 35/134 (26%)
CG13077NP_609990.1 Cytochrom_B561 94..228 CDD:281217 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.