DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and CG13078

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_609989.1 Gene:CG13078 / 35251 FlyBaseID:FBgn0032809 Length:222 Species:Drosophila melanogaster


Alignment Length:218 Identity:62/218 - (28%)
Similarity:99/218 - (45%) Gaps:3/218 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEGYTKATAWLQ-IHSLLNSINHILIFLVAVFFFILARSLEFKDTAMHMFMTGTGFHVLIAQAM 64
            |::..||.|:.|| |.|.|..||.:.|..|.::........:.....:|.::...||..|:|:.|
  Fly     1 MSDDKTKPTSVLQHIESALYVINQLCIGFVTIWISWTCLRQDLSGIRLHAWLVTFGFVFLMAEGM 65

  Fly    65 MSHSKVNPLTRWLSHRNKSRFHAILQIVGGSMVLLGSLGKFSSKEVHFN-TWHGRVGGAASFFCA 128
            |.....:.||...|...|:.||.:|||:||.|.:.|.|.:....:...: |.|.|:|.||...|.
  Fly    66 MCFYDGSWLTVRYSRNYKTAFHVVLQILGGGMGVAGCLIQLIRDDWSISVTLHARLGFAAFVLCL 130

  Fly   129 ASIVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSLGMGAIYLGYYSKFFTKYVDTDFIPGM 193
            .|::.|.|.:.....:..:.|.....| |.:.....|.:.|.|.:.||......:....||:..|
  Fly   131 ISLLSGLVAFLARCLSRTISPLVNKTF-HVVLSFTAFVIAMMAQFYGYTQTGIFRGQGQDFVVLM 194

  Fly   194 MLITGIVYGLTIIAPVSSLLTKL 216
            .::|.::..||.|..:.||..|:
  Fly   195 QVVTMVLMVLTSIGAIKSLYQKI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 39/135 (29%)
CG13078NP_609989.1 Cytochrom_B561 48..184 CDD:281217 39/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - P PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.