DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and CG10337

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_609986.1 Gene:CG10337 / 35247 FlyBaseID:FBgn0032805 Length:239 Species:Drosophila melanogaster


Alignment Length:229 Identity:57/229 - (24%)
Similarity:85/229 - (37%) Gaps:60/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 INHILIFLVAVFFFILARSLEFKDTAMHMFMTGTGFHVLIAQAMM------SHSKVNPLTRWLSH 79
            |:|:|:..:.|........|:...||.|.|....||...:.:|::      ..|.:.||      
  Fly    21 ISHVLLAGITVAIVYKCLVLKLVHTAGHAFYCTIGFVFFMGEALLVRNSAYLESSLGPL------ 79

  Fly    80 RNKSRFHAILQIVGGSMVLLGSLG-----KFSSKEV-------HFNTWHGRVGGAASFFCAASIV 132
             |.:|.||:|.:: ..:|..|.:|     |...|..       ||.:.|...|.........|::
  Fly    80 -NLNRLHAVLGLL-AFLVGAGGIGIKTWQKLERKREDPNATVRHFKSNHAFYGIIGCALLLGSVL 142

  Fly   133 GGFVNYF-QPKFALKVMPPSELRFRHNLFGLVTFSLGMGAIYLGYYS---------------KFF 181
            .|...|| ...||||::        |..|||..|.:.|.:...||.:               |||
  Fly   143 SGLPLYFINSGFALKML--------HRFFGLSGFLVLMVSQMFGYNTGFGRRQWKAHHQKLFKFF 199

  Fly   182 TKYVDTDFIPGMMLITGIVYGL-TIIAPVSSLLT 214
            | ::.|        ||...|.| ..:..|:.|.|
  Fly   200 T-FIAT--------ITTANYELRRFVRDVAGLAT 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 40/168 (24%)
CG10337NP_609986.1 B561 48..179 CDD:214769 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.