DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and CG3592

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_570039.1 Gene:CG3592 / 31282 FlyBaseID:FBgn0029642 Length:249 Species:Drosophila melanogaster


Alignment Length:194 Identity:46/194 - (23%)
Similarity:72/194 - (37%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEGYTKATAWLQIHS-----------------LLNSINHILIFLVAVFFFILARSLEFKDTAMH 48
            |::|....||.|..:.                 :|..:.|||:.::.|........|:...:..|
  Fly     1 MSQGENATTAKLVFYEFAWPLLVAVFEVNLYRIILELLAHILLIVITVVMVKKTSGLDDHSSGQH 65

  Fly    49 MFMTGTGFHVLIAQAMM-SHSKVNPLTRW-----LSHRNKSRFHAILQIVGGSMVLLGSLGK--F 105
            ......|..:.:.:::: .||       |     :|....:..|.:|.:||..:.|:|...|  |
  Fly    66 ALYAILGLFLCVGESLLVCHS-------WWLGDFISENRLNLLHMVLGMVGLWLGLVGIFAKSIF 123

  Fly   106 SSK--EVHFNTWHGRVGGAASFFCAASIVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSL 167
            .||  |.|||:.||..|.......|.::..||........||.|:        |.|.||..|.|
  Fly   124 KSKIHEPHFNSKHGLCGLLGFLLIAGAVASGFALVCFTHLALHVI--------HRLMGLCGFVL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 35/131 (27%)
CG3592NP_570039.1 Cyt_b561 65..189 CDD:176489 35/130 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15422
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.