DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and CYB561D1

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_011539589.2 Gene:CYB561D1 / 284613 HGNCID:26804 Length:290 Species:Homo sapiens


Alignment Length:193 Identity:46/193 - (23%)
Similarity:76/193 - (39%) Gaps:32/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MFMTG----TGFHVLIAQAMMSHSKVNPLTRWLSHRNKSRFHAILQIVGGSMVLLGSLG------ 103
            |.:||    :.|.:.:|:|::..|..:.|..:.|.:.:.|.|...|.:.   :|..:||      
Human   113 MRLTGSLLCSQFCLCMAEAILLFSPEHSLFFFCSRKARIRLHWAGQTLA---ILCAALGLGFIIS 174

  Fly   104 -KFSSKEVHFNTWHGRVGGAASFFCAASIVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSL 167
             :..|:..|..:||..||.......|...:.|.. ...|: |.:|...:.|:..|...|||.:.:
Human   175 SRTRSELPHLVSWHSWVGALTLLATAVQALCGLC-LLCPR-AARVSRVARLKLYHLTCGLVVYLM 237

  Fly   168 GMGAIYLGYYSKFFTKYVDTDFIPGMMLITGIVYGLTIIAPVSSLLTKL-----KYRSKKKAE 225
            ....:.||.||.:|           ...|.|..:.|.:..||...|..:     .|..:||.|
Human   238 ATVTVLLGMYSVWF-----------QAQIKGAAWYLCLALPVYPALVIMHQISRSYLPRKKME 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 35/143 (24%)
CYB561D1XP_011539589.2 Cyt_b561_CYB561D2_like 124..273 CDD:176491 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5503
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 1 1.000 - - FOG0003706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - O PTHR15422
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.