DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10165 and CYB561D2

DIOPT Version :9

Sequence 1:NP_001188850.1 Gene:CG10165 / 35242 FlyBaseID:FBgn0032801 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001278213.1 Gene:CYB561D2 / 11068 HGNCID:30253 Length:222 Species:Homo sapiens


Alignment Length:223 Identity:60/223 - (26%)
Similarity:95/223 - (42%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TKATAWLQIHSLLNSINHILIFLVAVFFFILAR---SLEFKDTAMHMFMTGTGFHVLIAQAMMSH 67
            |::..:..:.:...:..|::.....:|..:|||   ||    .:.|..:....|..|:.:|::..
Human     7 TESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSL----FSWHPVLMSLAFSFLMTEALLVF 67

  Fly    68 SKVNPLTRWLSHRNKSRFHAILQIVGGSMVLLG---------SLGKFSSKEVHFNTWHGRVGGAA 123
            |..:.|...||.:.::|.|.:||::.....|||         .|||     .|..|.||:.|..|
Human    68 SPESSLLHSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGK-----AHLVTRHGQAGLLA 127

  Fly   124 SFFCAASIVGGFVNYFQPKFALKVMPPSELRFRHNLFGLVTFSLGMGAIYLGYYSKFFTKYVDTD 188
            ..:......|| |....||. |...|.::|:..|...|||.:.||..::.||..|.:||..|   
Human   128 VLWAGLQCSGG-VGLLYPKL-LPRWPLAKLKLYHATSGLVGYLLGSASLLLGMCSLWFTASV--- 187

  Fly   189 FIPGMMLITGIVYGLTIIAPVSSLLTKL 216
                    ||..:.|.::.||   ||.|
Human   188 --------TGAAWYLAVLCPV---LTSL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10165NP_001188850.1 Cytochrom_B561 47..182 CDD:281217 41/143 (29%)
CYB561D2NP_001278213.1 Cyt_b561_CYB561D2_like 25..205 CDD:176491 58/205 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5503
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586923at2759
OrthoFinder 1 1.000 - - FOG0003706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104547
Panther 1 1.100 - - LDO PTHR15422
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10256
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.