DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and DPM1

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001303963.1 Gene:DPM1 / 8813 HGNCID:3005 Length:295 Species:Homo sapiens


Alignment Length:271 Identity:177/271 - (65%)
Similarity:210/271 - (77%) Gaps:35/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HKYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDKIVL 70
            :|||:|:|||||::|||:|:||:||....||:.||:|:|||||||||.|||:.|:||||.|:|:|
Human    25 NKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSDRILL 89

  Fly    71 RPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGNGGV 135
            |||..|||||||||||:|||||::|:|:|||||||||||||||:.|:|||:||||||||.|||||
Human    90 RPREKKLGLGTAYIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGV 154

  Fly   136 FGWDFKRKLI-----------------------------------SRGANFLSQVLLRPNASDLT 165
            :|||.|||:|                                   |||||||:|:||||.|||||
Human   155 YGWDLKRKIISDGVLPCCPGWSLLGSSDPAILASWDYRCEPPRLASRGANFLTQILLRPGASDLT 219

  Fly   166 GSFRLYKKDVLEKCIASCVSKGYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQF 230
            ||||||:|:||||.|..||||||||||||:|||||..|||.||||:||||:||.|||||.||:.|
Human   220 GSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSF 284

  Fly   231 AKNLLYLFATT 241
            .|.||.|||||
Human   285 LKGLLTLFATT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 175/269 (65%)
DPM1_like 10..237 CDD:133062 169/261 (65%)
DPM1NP_001303963.1 PLN02726 23..295 CDD:215385 175/269 (65%)
DPM1_like 29..291 CDD:133062 169/261 (65%)
GVQW 175..206 CDD:290611 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147572
Domainoid 1 1.000 285 1.000 Domainoid score I1628
eggNOG 1 0.900 - - E1_COG0463
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2865
Inparanoid 1 1.050 382 1.000 Inparanoid score I2060
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61609
OrthoDB 1 1.010 - - D1445102at2759
OrthoFinder 1 1.000 - - FOG0003124
OrthoInspector 1 1.000 - - oto91832
orthoMCL 1 0.900 - - OOG6_100818
Panther 1 1.100 - - LDO PTHR43398
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4337
SonicParanoid 1 1.000 - - X2989
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.